PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10004390m
Common NameCARUB_v10004390mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family WRKY
Protein Properties Length: 616aa    MW: 67516.4 Da    PI: 7.482
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10004390mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.31.2e-31267324260
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                      dDgynWrKYGqK+vkgsefprsYY+Ct+++C+vkk  ers+ d+++++i+Y+g+H+h+k
  Carubv10004390m 267 DDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSH-DGQITDIIYKGTHDHPK 324
                      8****************************************.***************85 PP

2WRKY106.61.2e-33438496159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+v+g+++prsYY+Ct agCpv+k+ver+++dpk+v++tYeg+Hnh+
  Carubv10004390m 438 LDDGYRWRKYGQKVVRGNPNPRSYYKCTAAGCPVRKHVERASHDPKAVITTYEGKHNHD 496
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.388261325IPR003657WRKY domain
SuperFamilySSF1182908.89E-25264325IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.1E-26265325IPR003657WRKY domain
SMARTSM007748.5E-34266324IPR003657WRKY domain
PfamPF031062.8E-24267323IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.8E-37423498IPR003657WRKY domain
SuperFamilySSF1182902.75E-29430498IPR003657WRKY domain
PROSITE profilePS5081138.825433498IPR003657WRKY domain
SMARTSM007747.7E-39438497IPR003657WRKY domain
PfamPF031064.6E-26439496IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 616 aa     Download sequence    Send to blast
MGVNFFLLSL IIIFTDAAEI HRELIKLSIR HSCERASSPS PIPLLASFFH LLGNPSEMNP  60
QANGRKEFQV DSSAAGDLTA RHDSSGGGGG ARYKLMSPAM LPISRSNADI TIPPGLSPTS  120
FLESPVFISN IKPEPSPTTG SLFKPRPVHI SASPSSYTGR AFHQNTFTEQ KSSEFEFRPP  180
ASNMVYAEVG KHRSEPPLQF QGQGHGSSHS PSSISDAAGS SSELSRPTPP RQMTSTSSDI  240
LAGSDQDESI QTSQNDSRGS TPSILADDGY NWRKYGQKHV KGSEFPRSYY KCTHPNCEVK  300
KLFERSHDGQ ITDIIYKGTH DHPKPQPGRR NSGGLGMAAQ EERLDKYPSS TGRDEKGSGV  360
YNVSHPNEQA GNPEIPHTTT TDDGGEAAAS NKNKDDPEDD DPFSKRRRMD GVMEITPLVK  420
PIREPRVVVQ TLSEVDILDD GYRWRKYGQK VVRGNPNPRS YYKCTAAGCP VRKHVERASH  480
DPKAVITTYE GKHNHDVPTS KSSSNHDIQP RFRPDETDTI SLNLGVGISS DGPNHTSNEH  540
QHQNQQLVNQ SHPNGVNFRF VHASPMPSYY ASLNSGMNQY GPRETKNETQ NGDISSLNHS  600
SYPYPPNIGR IQSGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-36265498877Probable WRKY transcription factor 4
2lex_A1e-36265498877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4258370.0AF425837.1 Arabidopsis thaliana WRKY transcription factor 20 (WRKY20) mRNA, complete cds.
GenBankAJ6304790.0AJ630479.1 Arabidopsis thaliana mRNA for hypothetical protein, clone At4g26640D.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006283345.10.0hypothetical protein CARUB_v10004390mg
SwissprotQ93WV00.0WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLR0GYJ60.0R0GYJ6_9BRAS; Uncharacterized protein
STRINGscaffold_701634.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31332867
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.20.0WRKY family protein